PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.175830.1
Common NameCsa_3G733340, LOC101221128
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TALE
Protein Properties Length: 481aa    MW: 54330.8 Da    PI: 7.4454
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.175830.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.99.5e-102773141954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LAk++gL+ +qV++WF N R +
  Cucsa.175830.1 277 FEHflHPYPSDTDKLMLAKQTGLSRSQVSNWFINARVR 314
                     554459******************************98 PP

2BELL86.33.4e-28167231872
            BELL   8 kkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      k+ Lls+l+eV+++Ykqy++q+q v+ sFe + glg+a+pY++ A ka+ +hF+cLk+ai +q+
  Cucsa.175830.1 167 HKSTLLSMLDEVYRKYKQYYQQIQEVMTSFEYISGLGNAAPYANQAIKAMYKHFKCLKNAILDQL 231
                     5899**********************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.4E-32100229IPR006563POX domain
PfamPF075263.3E-29105227IPR006563POX domain
PROSITE profilePS5007112.115255318IPR001356Homeobox domain
CDDcd000864.31E-13258319No hitNo description
SMARTSM003892.6E-10258322IPR001356Homeobox domain
SuperFamilySSF466892.52E-17260325IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.3E-28261323IPR009057Homeodomain-like
PfamPF059206.8E-19275314IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MAEGIESYDH VPQQSRRDKL REHPDHHHRS NFLPFYDPSS SDSSNRFQFH HHPFFDPQIQ  60
SPIFPEIHSF PTEPLSLSLS SHPNFLASPI TPPLPLGPFT GYASILKGSR FLKPAHHLLQ  120
DLCDSVHYSS SSSSFIHDPS SDSFPHSPIL DHHYPLPSSS DSSTPPHKST LLSMLDEVYR  180
KYKQYYQQIQ EVMTSFEYIS GLGNAAPYAN QAIKAMYKHF KCLKNAILDQ LQFNKKTHGD  240
YNQRSVQNPG FLDHQPVWRP QRGLPERAVT VLRAWLFEHF LHPYPSDTDK LMLAKQTGLS  300
RSQVSNWFIN ARVRLWKPMV EEIYMLETKQ QQTQKNLHKE DRTTTRVNDH HPSNPLTMEN  360
PSTSTQQIQD TPPKRTRNEP PDMPMGNHDE PLNVSYNLSS HPHVGANVNM AGNNGGVSLT  420
LGLHQNNGIG GFSEPFPVGF PVAATRRFGL GIQGNSDGYV MGGHFSRDVL GGQLLHDFVG  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B5e-16264322563Homeobox protein Meis2
3k2a_A5e-16264322563Homeobox protein Meis2
4xrm_B6e-16264322563Homeobox protein Meis2
4xrm_A6e-16264322563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818410.0LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137755.10.0PREDICTED: BEL1-like homeodomain protein 9
SwissprotQ9LZM81e-101BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBLA0A0A0LD130.0A0A0A0LD13_CUCSA; Uncharacterized protein
STRINGVIT_08s0007g01290.t011e-165(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.12e-85TALE family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]